- EFCAB2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-81219
- EFCAB2
- This antibody was developed against Recombinant Protein corresponding to amino acids: SLGISQATGS AARWRTRRTG KGLGYNSDEI RPRTLLIEHL MEGGRRDHHT MTVLWGTQEI IVAEFHKKIK EAFEVFDHES NNTVDVR
- 0.1 ml (also 25ul)
- Human
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- EF-hand calcium binding domain 2
- CFAP200, DRC8
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
SLGISQATGSAARWRTRRTGKGLGYNSDEIRPRTLLIEHLMEGGRRDHHTMTVLWGTQEIIVAEFHKKIKEAFEVFDHESNNTVDVR
Specifications/Features
Available conjugates: Unconjugated